PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG116700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 277aa    MW: 30286.5 Da    PI: 4.6299
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG116700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.47e-2080133356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k
  Pavir.6NG116700.1.p  80 KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 133
                          56789************************************************9 PP

2HD-ZIP_I/II132.61.4e-4279170192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl++eqv+lLE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE+dy++Lk+aydal+++++ L +++++Lr++
  Pavir.6NG116700.1.p  79 EKKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLETDYDRLKAAYDALAADHQGLLADNDSLRAQ 168
                          69**************************************************************************************99 PP

          HD-ZIP_I/II  91 lk 92 
                          + 
  Pavir.6NG116700.1.p 169 VI 170
                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.1E-1972138IPR009057Homeodomain-like
PROSITE profilePS5007118.20475135IPR001356Homeobox domain
SMARTSM003896.9E-1978139IPR001356Homeobox domain
CDDcd000863.99E-1880136No hitNo description
PfamPF000463.4E-1780133IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-2181142IPR009057Homeodomain-like
PRINTSPR000314.5E-6106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000314.5E-6115131IPR000047Helix-turn-helix motif
PfamPF021831.4E-16135177IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MDPGRVGVDS GGARRGGGGG GAQMLLFGGG GSANSNGFFR GVPTAVLGMD DAARVGKRPF  60
FTTHEELLEE YYYDEQAPEK KRRLTAEQVQ LLERSFEEEN KLEPERKTEL ARRLGMAPRQ  120
VAVWFQNRRA RWKTKQLETD YDRLKAAYDA LAADHQGLLA DNDSLRAQVI SLTEKLQGKD  180
TSPSATITAQ EVDQLDEHTV ASGTEKLLVQ LKDDHLSSGD CTGHGTLSSE EEDGGVISDE  240
VCSFDLPDAL FAAVGVTHRG AEEAQLCNWN SWLWNN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.78830.0callus| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973433.11e-160PREDICTED: homeobox-leucine zipper protein HOX5-like
SwissprotQ6ZA741e-112HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5
TrEMBLK3YJ091e-160K3YJ09_SETIT; Uncharacterized protein
STRINGSi014228m1e-160(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.16e-55homeobox 1